본문 바로가기

Beta Lifescience11

[Beta Lifescience] Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST) [Beta Lifescience] Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST) SKU/CAT #: BLC-08729P Description Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q9BZW8 Target Symbol CD244 Synonyms 2B4; C9.1; CD244; CD244 antig.. 2024. 2. 8.
[Beta Lifescience] Recombinant Human C-X-C Motif Chemokine 10 Protein (CXCL10) Protein (His) [Beta Lifescience] Recombinant Human C-X-C Motif Chemokine 10 Protein (CXCL10) Protein (His) SKU/CAT #: BLC-08409P Description Recombinant Human C-X-C Motif Chemokine 10 Protein (CXCL10) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P02778 Target Symbol CXCL10 Synonyms Interferon gamma induce.. 2023. 9. 6.
[Beta Lifescience] Recombinant Human Carboxypeptidase B2 Protein (His Tag) [Beta Lifescience] Recombinant Human Carboxypeptidase B2 Protein (His Tag) Catalog No.: BLPSN-0571 Tag His Host Species Human Accession NP_001863.2 Synonym CPU, PCPB, TAFI Background Carboxypeptidase B2, also known as Carboxypeptidase U, Thrombin-activable fibrinolysis inhibitor, Plasma carboxypeptidase B, CPB2, is a secreted protein which belongs to the peptidase M14 family. Carboxypeptidases a.. 2022. 10. 19.
[Beta LifeScience] Recombinant Mouse BRAK Protein [Beta LifeScience] Recombinant Mouse BRAK Protein Cat No.: BL-0138PS Tag N/A Host Species Mouse Synonym C-X-C motif chemokine 14, B-cell and monocyte-activating chemokine, Chemokine BRAK, Kidney-expressed chemokine CXC, MIP-2G, Small-inducible cytokine B14, Cxcl14, Bmac, Kec, Ks1, Mip2g, Scyb14, BRAK, NJAC, AI414372, bolekine, MIP2gamma, 1110031L23Rik, 1200006I23Rik. Background CXCL14 is involve.. 2021. 8. 17.
[Beta Lifescience] Streptavidin Protein (5nm Gold) [Beta Lifescience] Streptavidin Protein (5nm Gold) Cat No.: BLA-11196P Synonym SA V1 SA V2 strepavidin Streptavidin V1 Streptavidin V2 Description Streptavidin Protein (5nm Gold) was expressed in Saccharomyces cerevisiae. It is a Full length protein Source Saccharomyces cerevisiae Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method Formulation Liquid Solution Stability The r.. 2020. 8. 21.
[Beta Lifescience] Recombinant Human CCL27 Protein [Beta Lifescience] Recombinant Human CCL27 Protein Cat No.: BL-0142PS CTACK Human Recombinant (CCL27) Tag N/A Host Species Human Synonym ALP, CTACK, ESKINE, ILC, PESKY, SCYA27, CCL27, C-C motif chemokine 27, Small-inducible cytokine A27,IL-11 R-alpha-locus chemokine, Skinkine, ESkine, Cutaneous T-cell-attracting chemokine. Background CTACK is a chemotactic factor that attracts skin-associated me.. 2020. 8. 18.
[Beta Lifescience] Recombinant Streptavidin Protein [Beta Lifescience] Recombinant Streptavidin Protein Cat No.: BLA-11193P Host Species Streptomyces avidinii Accession P22629 Synonym SA V1 SA V2 strepavidin Streptavidin V1 Streptavidin V2 Description Recombinant Streptavidin Protein was expressed in E.coli. It is a Full length protein Source E.coli AA Sequence MASMTGGQQMGRGHHHHHHENLYFQGGEFDPSKDSKAQVSAAEAGITGTW YNQLGSTFIVTAGADGALTGTYESAVGNAESRYVL.. 2020. 7. 13.
[Beta Lifesciences] Native Human alpha 2 Macroglobulin / A2M Protein [Beta Lifesciences] Native Human alpha 2 Macroglobulin / A2M Protein Cat No.: BLA-11649P Host Species Human Synonym A2m A2MG_HUMAN Alpha 2 M Alpha 2M Alpha-2-M Alpha-2-macroglobulin C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5 CPAMD5 DKFZp779B086 FWP007 S863 7 Description Native Human alpha 2 Macroglobulin / A2M Protein is native.. It is a Full length protein Source Native P.. 2020. 6. 1.

티스토리툴바