[Beta Lifescience] Recombinant Human C-X-C Motif Chemokine 10 Protein (CXCL10) Protein (His)

SKU/CAT #: BLC-08409P
Description | Recombinant Human C-X-C Motif Chemokine 10 Protein (CXCL10) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P02778 |
Target Symbol | CXCL10 |
Synonyms | Interferon gamma induced factor MOB1; mouse; homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B; member 10; Small-inducible cytokine B10 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Expression Range | 22-98aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 12.6kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
'Beta Lifescience' 카테고리의 다른 글
[Beta Lifescience] Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST) (1) | 2024.02.08 |
---|---|
[Beta Lifescience] Recombinant Human Carboxypeptidase B2 Protein (His Tag) (0) | 2022.10.19 |
[Beta LifeScience] Recombinant Mouse BRAK Protein (0) | 2021.08.17 |
[Beta Lifescience] Streptavidin Protein (5nm Gold) (0) | 2020.08.21 |
[Beta Lifescience] Recombinant Human CCL27 Protein (0) | 2020.08.18 |