[Beta Lifescience] Recombinant Streptavidin Protein

[Beta Lifescience] Recombinant Streptavidin Protein

Cat No.: BLA-11193P

 

Host Species	Streptomyces avidinii
Accession	P22629
Synonym	SA V1 SA V2 strepavidin Streptavidin V1 Streptavidin V2
Description	Recombinant Streptavidin Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MASMTGGQQMGRGHHHHHHENLYFQGGEFDPSKDSKAQVSAAEAGITGTW YNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGT ALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWK STLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular Weight	20 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Activity: > 17U / mg (one unit = streptavidin binds 1 μg D-biotin at pH 8.9).
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80℃
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.