StreptavidinProtein2 [Beta Lifescience] Streptavidin Protein (5nm Gold) [Beta Lifescience] Streptavidin Protein (5nm Gold) Cat No.: BLA-11196P Synonym SA V1 SA V2 strepavidin Streptavidin V1 Streptavidin V2 Description Streptavidin Protein (5nm Gold) was expressed in Saccharomyces cerevisiae. It is a Full length protein Source Saccharomyces cerevisiae Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method Formulation Liquid Solution Stability The r.. 2020. 8. 21. [Beta Lifescience] Recombinant Streptavidin Protein [Beta Lifescience] Recombinant Streptavidin Protein Cat No.: BLA-11193P Host Species Streptomyces avidinii Accession P22629 Synonym SA V1 SA V2 strepavidin Streptavidin V1 Streptavidin V2 Description Recombinant Streptavidin Protein was expressed in E.coli. It is a Full length protein Source E.coli AA Sequence MASMTGGQQMGRGHHHHHHENLYFQGGEFDPSKDSKAQVSAAEAGITGTW YNQLGSTFIVTAGADGALTGTYESAVGNAESRYVL.. 2020. 7. 13. 이전 1 다음
