[Beta Lifescience] Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST)

[Beta Lifescience]  Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST)

 

SKU/CAT #: BLC-08729P

 

 

Description	Recombinant Human Natural Killer Cell Receptor 2B4 (CD244) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9BZW8
Target Symbol	CD244
Synonyms	2B4; C9.1; CD244; CD244 antigen; CD244 molecule; CD244 molecule natural killer cell receptor 2B4 ; CD244 natural killer cell receptor 2B4; CD244_HUMAN; F730046O15Rik; h2B4; Ly90; NAIL; Natural killer cell activation-inducing ligand; Natural killer cell receptor 2B4; NK cell activation inducing ligand; NK cell activation inducing ligand NAIL ; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NKR2B4; Nmrk; Non-MHC restricted killing associated; OTTHUMP00000027884 ; p38; signaling lymphocytic activation molecule 4; SLAM family, member 4; SLAMF4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQN
Expression Range	21-215aa
Protein Length	Partial
Mol. Weight	48.5 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.